Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium meliloti UPF0060 membrane protein R01043(R01043)

Recombinant Rhizobium meliloti UPF0060 membrane protein R01043(R01043)

SKU:CSB-CF849947RKU

Regular price $2,025.80 CAD
Regular price Sale price $2,025.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Uniprot NO.:Q92R68

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPAYAIYFLAALAEITGCFAFWSWLRLGKSALWLIPGMASLALFAWLLTMVDAAAAGRTY AAYGGVYIVASLSWLWLAEGVRPDHWDMTGAAVALAGSAIILAGPR

Protein Names:Recommended name: UPF0060 membrane protein R01043

Gene Names:Ordered Locus Names:R01043 ORF Names:SMc02387

Expression Region:1-106

Sequence Info:full length protein

View full details