Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium meliloti Probable K(+)-H(+) antiporter subunit F(phaF)

Recombinant Rhizobium meliloti Probable K(+)-H(+) antiporter subunit F(phaF)

SKU:CSB-CF690435RKU

Regular price $2,004.80 CAD
Regular price Sale price $2,004.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Uniprot NO.:Q52983

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELAVVWSVLVAQTMLALAMAFALYRMARGPRAQDRILGLDTLYINAMLMLITFGIRTAN TVYFETALIIAVIGFASSIALAKFLMRGEVIE

Protein Names:Recommended name: Probable K(+)/H(+) antiporter subunit F Alternative name(s): pH adaptation potassium efflux system protein F Short name= Pha system subunit F

Gene Names:Name:phaF Synonyms:phaF1 Ordered Locus Names:R02914 ORF Names:SMc03183

Expression Region:1-92

Sequence Info:full length protein

View full details