Gene Bio Systems
Recombinant Rhizobium loti Large-conductance mechanosensitive channel 3(mscL3)
Recombinant Rhizobium loti Large-conductance mechanosensitive channel 3(mscL3)
SKU:CSB-CF853753RCU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Uniprot NO.:Q98B79
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKEFQEFISKGNVMDLAVGVIIGAAFGKIVTSLVDDVIMPIFGAIFGGLDFNNYYIGLS SAVNATSLAEAKKQGAVFAYGSFITAVLNFLILAFIIFLMVKAVNNLRRRLEREKPAAPA APPPADVALLTEIRDLLAKR
Protein Names:Recommended name: Large-conductance mechanosensitive channel 3
Gene Names:Name:mscL3 Ordered Locus Names:mlr5692
Expression Region:1-140
Sequence Info:full length protein
