Gene Bio Systems
Recombinant Rhizobium loti Large-conductance mechanosensitive channel 1(mscL1)
Recombinant Rhizobium loti Large-conductance mechanosensitive channel 1(mscL1)
SKU:CSB-CF857293RCU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)
Uniprot NO.:Q98DH7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKEFQEFISKGNVMDLAVGVIIGAAFGKIVDSLVNDIIMPIIGAIFGGLDFNNYFVGLS SAVNATSLADARKQGAVLAYGSFITVALNFVILAFIIFLMVKAVNNLRKRLEREKPAAAA PPPADIALLTQIRDLLARK
Protein Names:Recommended name: Large-conductance mechanosensitive channel 1
Gene Names:Name:mscL1 Ordered Locus Names:mll4699
Expression Region:1-139
Sequence Info:full length protein
