Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium loti Large-conductance mechanosensitive channel 1(mscL1)

Recombinant Rhizobium loti Large-conductance mechanosensitive channel 1(mscL1)

SKU:CSB-CF857293RCU

Regular price $2,074.80 CAD
Regular price Sale price $2,074.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)

Uniprot NO.:Q98DH7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKEFQEFISKGNVMDLAVGVIIGAAFGKIVDSLVNDIIMPIIGAIFGGLDFNNYFVGLS SAVNATSLADARKQGAVLAYGSFITVALNFVILAFIIFLMVKAVNNLRKRLEREKPAAAA PPPADIALLTQIRDLLARK

Protein Names:Recommended name: Large-conductance mechanosensitive channel 1

Gene Names:Name:mscL1 Ordered Locus Names:mll4699

Expression Region:1-139

Sequence Info:full length protein

View full details