Recombinant Rhizobium leguminosarum Nitrogenase iron protein(nifH)

SKU: CSB-EP321828RKN

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P20623

Gene Names: nifH

Organism: Rhizobium leguminosarum

AA Sequence: MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ

Expression Region: 1-47aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

MW: 35 kDa

Alternative Name(s): Nitrogenase Fe protein Nitrogenase component II Nitrogenase reductase

Relevance: The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein.

Reference: "The nifH promoter region of Rhizobium leguminosarum: nucleotide sequence and promoter elements controlling activation by NifA protein." Roelvink P.W., Harmsen M., van Kammen A., van den Bos R.C. Gene 87:31-36(1990)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.