Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium leguminosarum bv. trifolii ATP synthase subunit b-b'(atpG)

Recombinant Rhizobium leguminosarum bv. trifolii ATP synthase subunit b-b'(atpG)

SKU:CSB-CF481304RKQ

Regular price $2,174.20 CAD
Regular price Sale price $2,174.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. trifolii (strain WSM2304)

Uniprot NO.:B5ZS18

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTYASQLLW LVITFSVFYLLMQKVIAPRIGAILDQRHTRLSQDLEEAGRLKAEADAAVQTYEGELAAAR AKSNAIGAAARDAAKLKAEEDRRAVEASLSEKIKAAEVRIADIKAKAFADVGTIAEETAA AVVEQLIGGTAAQADVAAAVAAAKKEA

Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b'

Gene Names:Name:atpG Ordered Locus Names:Rleg2_0514

Expression Region:1-207

Sequence Info:full length protein

View full details