Gene Bio Systems
Recombinant Rhizobium etli Energy-coupling factor transporter transmembrane protein BioN(bioN)
Recombinant Rhizobium etli Energy-coupling factor transporter transmembrane protein BioN(bioN)
SKU:CSB-CF641580RKK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium etli (strain CFN 42 / ATCC 51251)
Uniprot NO.:Q2KBP6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQSLYVEGNSRMHRLSPRAKLLSLTAFAILLFISHNLLLLSGAVLVAAVLYGTVGLPIGE ALLRLRPIFLTIAVVALFNLIFNPWQAALVPVLRLTALMLLAASVTATTTITEFIDEVTA LARPLERTGRVQADDIGLALGLVLRFVPEIVNRYQAIREAHKARGLKVRPTSLLAPLIIL TLKDADNVAAAIDARRIRRHGS
Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein BioN Short name= ECF transporter T component BioN
Gene Names:Name:bioN Ordered Locus Names:RHE_CH00929
Expression Region:1-202
Sequence Info:full length protein
