Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P03065
Gene Names: repD
Organism: Staphylococcus aureus
AA Sequence: MSTENHSNYLQNKDLDNFSKTGYSNSRLSGNFFTTPQPELSFDAMTIVGNLNKTNAKKLSDFMSTEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNMRVEFNPNKLTHEEMLWLKQNIIDYMEDDGFTRLDLAFDFEDDLSDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADVEVMSEHLWRVEIELKRDMVDYWNDCFDDLHILKPDWTTPEKVKEQAMVYLLLNEEGTWGKLERHAKYKYKQLIKEISPIDLTELMKSTLKENEKQLQKQIDFWQREFRFWK
Expression Region: 1-311aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 53.5 kDa
Alternative Name(s):
Relevance: This protein is probably a specific topoisomerase involved in initiating replication. This protein is specifically required and may be rate-limiting for replication of the plasmid in vivo.
Reference: "The use of synthetic oligonucleotides with universal templates for rapid DNA sequencing: results with staphylococcal replicon pC221." Brenner D.G., Shaw W.V.EMBO J. 4:561-568(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.