Gene Bio Systems
Recombinant Rat Type-1 angiotensin II receptor-associated protein(Agtrap)
Recombinant Rat Type-1 angiotensin II receptor-associated protein(Agtrap)
SKU:CSB-CF727055RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q642A2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MELPAVNLKVILLVHWLLTTWGCLAFSGSYAWGNFTILALGVWAVAQRDSVDAIGMFLGG LVATIFLDIIYISIFYSSVAVGDTGRFSAGMAIFSLLLKPFSCCLVYHMHRERGGELPLR SDFFGPSQEHSAYQTIDSSDSPADPLASLENKGQAAPRGY
Protein Names:Recommended name: Type-1 angiotensin II receptor-associated protein Alternative name(s): AT1 receptor-associated protein
Gene Names:Name:Agtrap Synonyms:Atrap
Expression Region:1-160
Sequence Info:full length protein
