Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Tumor protein p53-inducible protein 11(Tp53i11)

Recombinant Rat Tumor protein p53-inducible protein 11(Tp53i11)

SKU:CSB-CF024082RA

Regular price $2,147.60 CAD
Regular price Sale price $2,147.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:B3DMA0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFAVREPL GLRVWQFLSAMLFSSVAIMALALPDQLYDAVFDGAEVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFGVQSLVVTATLAETGLMSLGTLLLLASRLLFVIVSIYYYY QVGRKPKKV

Protein Names:Recommended name: Tumor protein p53-inducible protein 11 Alternative name(s): p53-induced gene 11 protein

Gene Names:Name:Tp53i11 Synonyms:Pig11

Expression Region:1-189

Sequence Info:Full length protein

View full details