Recombinant Rat Tryptase(Tpsab1)

Recombinant Rat Tryptase(Tpsab1)

CSB-EP024127RA
Regular price
$907.00 CAD
Sale price
$907.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Immunology

Target / Protein: Tpsab1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Rattus norvegicus (Rat)

Delivery time: 3-7 business days

Uniprot ID: P27435

AA Sequence: IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIYRYVPKYF

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 29-273aa

Protein length: Full Length of Mature Protein

MW: 47.4 kDa

Alternative Name(s): Mast cell protease 7

Relevance: Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity

Reference: "Secretory granule proteases in rat mast cells. Cloning of 10 different serine proteases and a carboxypeptidase A from various rat mast cell populations." Lutzelschwab C., Pejler G., Aveskogh M., Hellman L. J. Exp. Med. 185:13-29(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share