Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Syndecan-4(Sdc4)

Recombinant Rat Syndecan-4(Sdc4)

SKU:CSB-CF020891RA

Regular price $2,133.60 CAD
Regular price Sale price $2,133.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P34901

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGLEQDSDFELSGSGDLDDTEEPRTFPEVISPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRVPSDVGDDDVSNKVSMSSTSQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA

Protein Names:Recommended name: Syndecan-4 Short name= SYND4 Alternative name(s): Ryudocan core protein

Gene Names:Name:Sdc4 Synonyms:Synd4

Expression Region:24-202

Sequence Info:full length protein

View full details