Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Proline-rich protein 7(Prr7)

Recombinant Rat Proline-rich protein 7(Prr7)

SKU:CSB-CF018797RA

Regular price $2,266.60 CAD
Regular price Sale price $2,266.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P0C6T3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPPPPHRSRLEAPVHAHSHVHVHPLLHHGPAQPHAHPHPHHHALPHPPPSHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAAPCPALCLQADRSRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV

Protein Names:Recommended name: Proline-rich protein 7 Alternative name(s): Synaptic proline-rich membrane protein

Gene Names:Name:Prr7

Expression Region:1-269

Sequence Info:full length protein

View full details