Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Prenylated Rab acceptor protein 1(Rabac1)

Recombinant Rat Prenylated Rab acceptor protein 1(Rabac1)

SKU:CSB-CF019227RA

Regular price $1,912.50 CAD
Regular price Sale price $1,912.50 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O35394

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAQKDQQKDAEVEGLSATTLLPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNV GELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLQSKLV LFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLIGSHAAFHQIEPADGEEL QMEPV

Protein Names:Recommended name: Prenylated Rab acceptor protein 1 Alternative name(s): PRA1 family protein 1

Gene Names:Name:Rabac1 Synonyms:Pra1, Praf1

Expression Region:1-185

Sequence Info:Full length protein

View full details