Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Potassium voltage-gated channel subfamily E member 1(Kcne1)

Recombinant Rat Potassium voltage-gated channel subfamily E member 1(Kcne1)

SKU:CSB-CF012025RA

Regular price $2,060.80 CAD
Regular price Sale price $2,060.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P15383

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALSNSTTVLPFLASLWQETDEPGGNMSADLARRSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKALFQARVLESFRACYVIENQAAVEQPATHLPELKPLS

Protein Names:Recommended name: Potassium voltage-gated channel subfamily E member 1 Alternative name(s): Delayed rectifier potassium channel subunit IsK IKs producing slow voltage-gated potassium channel subunit beta Mink Minimal potassium channel

Gene Names:Name:Kcne1

Expression Region:1-130

Sequence Info:full length protein

View full details