Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Peroxisomal membrane protein 11A(Pex11a)

Recombinant Rat Peroxisomal membrane protein 11A(Pex11a)

SKU:CSB-CF017795RA

Regular price $1,993.75 CAD
Regular price Sale price $1,993.75 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O70597

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKAGKEAVVTKLKNLETSVSTGRKWFR LGNVLHAIQATEQSIQATDLVPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGINREKWQ MRAARHYYYFLLLSLVRDLYEVLLHMGQVARDRAKREKSSGDPPKYSVANEESEWLQSFL LLLFQSLKRNPPLFLDTVKNFCDILIPLNQLGIYKSNLGVVGFGGLVSSVAGLITVVYPQ LKLKAR

Protein Names:Recommended name: Peroxisomal membrane protein 11A Alternative name(s): 28 kDa peroxisomal integral membrane protein Short name= PMP28 Peroxin-11A Peroxisomal biogenesis factor 11A Peroxisomal coatomer receptor Peroxisomal m

Gene Names:Name:Pex11a Synonyms:Pex11

Expression Region:1-246

Sequence Info:Full length protein

View full details