Recombinant Rat Osteocalcin(Bglap)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Osteocalcin(Bglap)

CSB-EP002682RA
Regular price
$907.00 CAD
Sale price
$907.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P04640

Gene Names: Bglap

Organism: Rattus norvegicus (Rat)

AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV

Expression Region: 50-99aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 32.6 kDa

Alternative Name(s): Bone Gla protein ;BGPGamma-carboxyglutamic acid-containing protein

Relevance: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Reference: Structure of the rat osteocalcin gene and regulation of vitamin D-dependent expression.Lian J., Stewart C., Puchacz E., Mackowiak S., Shalhoub V., Collart D., Zambetti G., Stein G.Proc. Natl. Acad. Sci. U.S.A. 86:1143-1147(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share