Recombinant Rat Natriuretic peptides B(NPPB),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Natriuretic peptides B(NPPB),partial

CSB-RP102944r(nt)
Regular price
$1,133.75 CAD
Sale price
$1,133.75 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P13205

Gene Names: NPPB

Organism: Rattus norvegicus (Rat)

AA Sequence: HPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLR

Expression Region: 27-76aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 32.8 kDa

Alternative Name(s): Gamma-brain natriuretic peptideIso-ANP

Relevance: Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3 .

Reference: Cloning and sequence analysis of cDNA encoding a precursor for rat brain natriuretic peptide.Kojima M., Minamino N., Kangawa K., Matsuo H.Biochem. Biophys. Res. Commun. 159:1420-1426(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share