Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial

Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial

CSB-YP015267RA
Regular price
$904.00 CAD
Sale price
$904.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P56741

Gene Names: Mybpc3

Organism: Rattus norvegicus (Rat)

AA Sequence: PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF

Expression Region: 645-864aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 26.1 kDa

Alternative Name(s): C-protein, cardiac muscle isoform

Relevance: Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.

Reference: Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.Cardiac myosin-binding protein C (MyBP-C) identification of protein kinase A and protein kinase C phosphorylation sites.Mohamed A.S., Dignam J.D., Schlender K.K.Arch. Biochem. Biophys. 358:313-319(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share