Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Lysosome-associated membrane glycoprotein 2(Lamp2)

Recombinant Rat Lysosome-associated membrane glycoprotein 2(Lamp2)

SKU:CSB-CF012740RA

Regular price $2,438.80 CAD
Regular price Sale price $2,438.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P17046

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ALKLNLTDSKGTCLYAEWEMNFTITYEALKVNETVTITVPDKVTYNGSSCGDDKNGAKIMIQYGSTLSWAVNFTKEASQYFINNITLSYNTNDTKTFPGAVPKGILTVIIPVGSQLPLGVIFKCSSVLTFNLSPVVQHYWGIHLQAFVQNGTVSKHEQVCKEDKTATTVAPIIHTTVPSPTTTLTPTSIPVPTPTVGNYTISNGNATCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQTAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVNMYLANGSAFHVSNNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTKGEYSTAQDCSADEDNFLVPIAVGAALGGVLILVLLAYFIGLKRHHTGYEQF

Protein Names:Recommended name: Lysosome-associated membrane glycoprotein 2 Short name= LAMP-2 Short name= Lysosome-associated membrane protein 2 Alternative name(s): CD107 antigen-like family member B LGP-110 LGP-96 Lysosomal membrane glycoprotein type B Short name= LGP-B CD_antigen= CD107b

Gene Names:Name:Lamp2 Synonyms:Lamp-2

Expression Region:26-411

Sequence Info:full length protein

View full details