Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Lipoma HMGIC fusion partner(Lhfp)

Recombinant Rat Lipoma HMGIC fusion partner(Lhfp)

SKU:CSB-CF012912RA

Regular price $2,130.80 CAD
Regular price Sale price $2,130.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q5BJS2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSTEWR ICTIVTGLGCGLLLLVALTALMGCCVSELISRTVGRVAGGIQFLGGLLIGAGCALYPLGW DSEEVRQTCGYISDQFDLGKCEIGWAYYCTGAGAAAAMLLCTWLACFSGKKQKHYPY

Protein Names:Recommended name: Lipoma HMGIC fusion partner

Gene Names:Name:Lhfp

Expression Region:24-200

Sequence Info:full length protein

View full details