Gene Bio Systems
Recombinant Rat Interleukin-2 receptor subunit alpha(Il2ra)
Recombinant Rat Interleukin-2 receptor subunit alpha(Il2ra)
SKU:CSB-CF011649RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P26897
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVASCIFLLLSILLLSGFTWQHRWRKSRRTI
Protein Names:Recommended name: Interleukin-2 receptor subunit alpha Short name= IL-2 receptor subunit alpha Short name= IL-2-RA Short name= IL-2R subunit alpha Short name= IL2-RA Alternative name(s): CD_antigen= CD25
Gene Names:Name:Il2ra
Expression Region:22-267
Sequence Info:full length protein
