Gene Bio Systems
Recombinant Rat Insulin-1(Ins1),partial
Recombinant Rat Insulin-1(Ins1),partial
SKU:CSB-EP355622RA-GB
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P01322
Gene Names: Ins1
Organism: Rattus norvegicus (Rat)
AA Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Expression Region: 25-54aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 19.4 kDa
Alternative Name(s): Ins-1
Relevance: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Reference: "Primary structures of the proinsulin connecting peptides of the rat and the horse." Tager H.S., Steiner D.F. J. Biol. Chem. 247:7936-7940(1972)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.