Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat IgG receptor FcRn large subunit p51(Fcgrt)

Recombinant Rat IgG receptor FcRn large subunit p51(Fcgrt)

SKU:CSB-CF008545RA

Regular price $2,377.20 CAD
Regular price Sale price $2,377.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P13599

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AEPRLPLMYHLAAVSDLSTGLPSFWATGWLGAQQYLTYNNLRQEADPCGAWIWENQVSWYWEKETTDLKSKEQLFLEAIRTLENQINGTFTLQGLLGCELAPDNSSLPTAVFALNGEEFMRFNPRTGNWSGEWPETDIVGNLWMKQPEAARKESEFLLTSCPERLLGHLERGRQNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSPARSSVPVVGIILGLLLVVVAIAGGVLLWNRMRSGLPAPWLSLSGDDSGDLLPGGNLPPEAEPQGVNAFPATS

Protein Names:Recommended name: IgG receptor FcRn large subunit p51 Short name= FcRn Alternative name(s): IgG Fc fragment receptor transporter alpha chain Neonatal Fc receptor

Gene Names:Name:Fcgrt Synonyms:Fcrn

Expression Region:23-366

Sequence Info:full length protein

View full details