Recombinant Rat GTPase HRas(Hras)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat GTPase HRas(Hras)

CSB-RP155374r
Regular price
$979.56 CAD
Sale price
$979.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P20171

Gene Names: Hras

Organism: Rattus norvegicus (Rat)

AA Sequence: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Expression Region: 2-186aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 24.9 kDa

Alternative Name(s): H-Ras-1Transforming protein p21c-H-rasp21ras

Relevance: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Reference: RGS14 is a multifunctional scaffold that integrates G protein and Ras/Raf MAPkinase signalling pathways.Shu F.J., Ramineni S., Hepler J.R.Cell. Signal. 22:366-376(2010)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share