Gene Bio Systems
Recombinant Rat Glutathione S-transferase P(Gstp1)
Recombinant Rat Glutathione S-transferase P(Gstp1)
SKU:CSB-EP009989RA
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P04906
Gene Names: Gstp1
Organism: Rattus norvegicus (Rat)
AA Sequence: PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ
Expression Region: 2-210aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 27.3 kDa
Alternative Name(s): Chain 7GST 7-7GST class-pi
Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration .
Reference: Cloning and the nucleotide sequence of rat glutathione S-transferase P cDNA.Suguoka Y., Kano T., Okuda A., Sakai M., Kitagawa T., Muramatsu M.Nucleic Acids Res. 13:6049-6057(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
