Gene Bio Systems
Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial
Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial
SKU:CSB-YP009514RA1-GB
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Neuroscience
Uniprot ID: P32301
Gene Names: Glp1r
Organism: Rattus norvegicus (Rat)
AA Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
Expression Region: 22-135aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 15.1 kDa
Alternative Name(s):
Relevance: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Reference: "Expression cloning of the pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1."Thorens B.Proc. Natl.Acad. Sci. U.S.A. 89:8641-8645(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
