Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

SKU: P43219

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Obesity

Uniprot ID: P43219

Gene Names: Gipr

Alternative Name(s): Gastric inhibitory polypeptide receptor; GIP-R;Glucose-dependent insulinotropic polypeptide receptor; Gipr

Abbreviation: Recombinant Rat Gipr protein, partial (Active)

Organism: Rattus norvegicus (Rat)

Source: Mammalian cell

Expression Region: 19-135aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ

MW: 14.9 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO)， the EC50 is 26.97 - 33.90 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May play an important role in blood sugar regulation.

Reference: "The cysteine of the cytoplasmic tail of glucose-dependent insulinotropic peptide receptor mediates its chronic desensitization and down- regulation."Tseng C.C., Zhang X.Y.Mol Cell Endocrinol 139: 179-186 (1998)

Function: