Gene Bio Systems
Recombinant Rat FXYD domain-containing ion transport regulator 7(Fxyd7)
Recombinant Rat FXYD domain-containing ion transport regulator 7(Fxyd7)
SKU:CSB-CF009097RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P59649
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MATPTQSPTNVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIIISKKVKCRKADSRSES PTCKSCKSELPSSAPGGGGV
Protein Names:Recommended name: FXYD domain-containing ion transport regulator 7
Gene Names:Name:Fxyd7
Expression Region:1-80
Sequence Info:Full length protein
