Gene Bio Systems
Recombinant Rat Epithelial membrane protein 3(Emp3)
Recombinant Rat Epithelial membrane protein 3(Emp3)
SKU:CSB-CF007650RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q9QYW5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLLLLVVSALHILILVLLFVATLDKSWWTLPEKESLNLWYDCTWNTTAKTWACSNVSEN GWLKAVQALMVLSLILCCLSFILFMIQLYTMRRGGLFYATGLCQLCTSAAVFSGALIYAI HAKEILAKHPSGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Protein Names:Recommended name: Epithelial membrane protein 3 Short name= EMP-3
Gene Names:Name:Emp3
Expression Region:1-163
Sequence Info:full length protein
