Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Epithelial cell adhesion molecule(Epcam)

Recombinant Rat Epithelial cell adhesion molecule(Epcam)

SKU:CSB-CF007717RA

Regular price $2,300.20 CAD
Regular price Sale price $2,300.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O55159

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVVLAVIAGIVVLVISTRKRSAKYEKAEIKEMGEIHRELNA

Protein Names:Recommended name: Epithelial cell adhesion molecule Short name= Ep-CAM Alternative name(s): Epithelial glycoprotein 314 Short name= EGP314 Protein D5.7A Tumor-associated calcium signal transducer 1 CD_antigen= CD326

Gene Names:Name:Epcam Synonyms:Tacstd1

Expression Region:24-315

Sequence Info:full length protein

View full details