Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat E3 ubiquitin-protein ligase RNF152(Rnf152)

Recombinant Rat E3 ubiquitin-protein ligase RNF152(Rnf152)

SKU:CSB-CF019848RA

Regular price $2,168.60 CAD
Regular price Sale price $2,168.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:D4A723

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKL PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERTLLPGDMGCR LLPGSQQKSLTVVTIPAEQQPLQGGAPQEAVEEEPDRRGVAKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG

Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF152 EC= 6.3.2.- Alternative name(s): RING finger protein 152

Gene Names:Name:Rnf152

Expression Region:1-203

Sequence Info:Full length protein

View full details