Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q7TQ16
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPPFVLFYLIY TWGNQEFAQSKRKNPAKYENDK
Protein Names:Recommended name: Cytochrome b-c1 complex subunit 8 Alternative name(s): Complex III subunit 8 Complex III subunit VIII Low molecular mass ubiquinone-binding protein Ubiquinol-cytochrome c reductase complex 9.5 kDa protein Ubiquino
Gene Names:Name:Uqcrq Synonyms:Qpc
Expression Region:1-82
Sequence Info:full length protein