Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Cytochrome b-c1 complex subunit 8(Uqcrq)

Recombinant Rat Cytochrome b-c1 complex subunit 8(Uqcrq)

SKU:CSB-CF763178RA

Regular price $1,990.80 CAD
Regular price Sale price $1,990.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q7TQ16

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPPFVLFYLIY TWGNQEFAQSKRKNPAKYENDK

Protein Names:Recommended name: Cytochrome b-c1 complex subunit 8 Alternative name(s): Complex III subunit 8 Complex III subunit VIII Low molecular mass ubiquinone-binding protein Ubiquinol-cytochrome c reductase complex 9.5 kDa protein Ubiquino

Gene Names:Name:Uqcrq Synonyms:Qpc

Expression Region:1-82

Sequence Info:full length protein

View full details