
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Signal Transduction
Target / Protein: Cpa1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Rattus norvegicus (Rat)
Delivery time: 3-7 business days
Uniprot ID: P00731
AA Sequence: ALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 111-419aa
Protein length: Full Length of Mature Protein
MW: 39.6 kDa
Alternative Name(s): Cpa
Relevance: Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro.
Reference: "Rat preprocarboxypeptidase A: cDNA sequence and preliminary characterization of the gene." Quinto C., Quiroga M., Swain W.F., Nikovits W.C. Jr., Standring D.N., Pictet R.L., Valenzuela P., Rutter W.J. Proc. Natl. Acad. Sci. U.S.A. 79:31-35(1982)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.