Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Carbohydrate sulfotransferase 11(Chst11)

Recombinant Rat Carbohydrate sulfotransferase 11(Chst11)

SKU:CSB-CF005404RA

Regular price $2,389.80 CAD
Regular price Sale price $2,389.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P69478

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAILHQMRRDQVTDTCRANSAMSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLSGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNTSFHKRYGTKIIRRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLRLAGVSGYLKFPTYAKSTRTTDEMTTEFFQNISAEHQTQLYEVYKLDFLMFNYSVPNYLKLD

Protein Names:Recommended name: Carbohydrate sulfotransferase 11 EC= 2.8.2.5 Alternative name(s): Chondroitin 4-O-sulfotransferase 1 Chondroitin 4-sulfotransferase 1 Short name= C4S-1 Short name= C4ST-1 Short name= C4ST1

Gene Names:Name:Chst11

Expression Region:1-352

Sequence Info:full length protein

View full details