Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Carbohydrate sulfotransferase 10(Chst10)

Recombinant Rat Carbohydrate sulfotransferase 10(Chst10)

SKU:CSB-CF005403RA

Regular price $2,395.40 CAD
Regular price Sale price $2,395.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O54702

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDGYSAKQEFVFLTAMPEAEKLRGEKHFSEVMKPTGKMLSESHPDQPPVYLERLELIRNACKEEALRNLSHTEVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSKIGIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRKNRTETRGIQFEDFVRYLGDPNRRWLDLQFGDHIIHWVTYVKLCAPCEIKYSVIGHHETLEADAPYILKEAGIDHLVSYPTIPPGITMYNRTKVEQYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLN

Protein Names:Recommended name: Carbohydrate sulfotransferase 10 EC= 2.8.2.- Alternative name(s): HNK-1 sulfotransferase Short name= HNK-1ST Short name= HNK1ST Short name= RaHNK-1ST Short name= Sul-T

Gene Names:Name:Chst10

Expression Region:1-356

Sequence Info:full length protein

View full details