Gene Bio Systems
Recombinant Rat Bladder cancer-associated protein(Blcap)
Recombinant Rat Bladder cancer-associated protein(Blcap)
SKU:CSB-CF002712RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P62950
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT
Protein Names:Recommended name: Bladder cancer-associated protein Alternative name(s): Bladder cancer 10 kDa protein Short name= Bc10
Gene Names:Name:Blcap
Expression Region:1-87
Sequence Info:Full length protein
