Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Beta-1,3-galactosyltransferase 4(B3galt4)

Recombinant Rat Beta-1,3-galactosyltransferase 4(B3galt4)

SKU:CSB-CF002492RA

Regular price $2,417.80 CAD
Regular price Sale price $2,417.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O88178

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPLSLFRRLLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNPQACGGSGPPPFLLILVCTAPEHLNQRNAIRGSWGAIREARGFRVQTLFLLGEPMGQQFADLASESAAQGDVLQASFQDSYRNLTLKTLTGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEPQEETTAVHKEHKGQAVPLLYLGRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPYLPLEDVFVGVSARRVGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPWKMQEAWKLVRGLNGRRTEPFCSWLQGFLGTLRCRFIAWLNS

Protein Names:Recommended name: Beta-1,3-galactosyltransferase 4 Short name= Beta-1,3-GalTase 4 Short name= Beta3Gal-T4 Short name= Beta3GalT4 Short name= b3Gal-T4 EC= 2.4.1.62 Alternative name(s): Gal-T2 Ganglioside galactosyltransferase UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase

Gene Names:Name:B3galt4

Expression Region:1-371

Sequence Info:full length protein

View full details