Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit Proteolipid protein 2(PLP2)

Recombinant Rabbit Proteolipid protein 2(PLP2)

SKU:CSB-CF842568RB

Regular price $2,093.00 CAD
Regular price Sale price $2,093.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:Q95MN6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADSERLSAPGCWAACTTFSRTRKGILLLAEIILCLVILICFSAGTSGYSSLSVVEMVLA IVFFVIYMCDLHTRAPFINWPWSDFFRTLIAAILYLITSIFVLVERGNHSKIAAGVLGLL ATCLFGYDAYFTFPLRQQRHTAAPTDPTDGPV

Protein Names:Recommended name: Proteolipid protein 2

Gene Names:Name:PLP2

Expression Region:1-152

Sequence Info:full length protein

View full details