Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Signal Transduction
Uniprot ID: P26013
Gene Names: ITGB8
Organism: Oryctolagus cuniculus (Rabbit)
AA Sequence: PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL
Expression Region: 146-384aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged
MW: 30.4 kDa
Alternative Name(s):
Relevance: Integrin alpha-V/beta-8 is a receptor for fibronectin.
Reference: "Cloning and expression of a divergent integrin subunit beta 8." Moyle M., Napier M.A., McLean J.W. J. Biol. Chem. 266:19650-19658(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.