Gene Bio Systems
Recombinant Rabbit E-selectin (SELE),partial
Recombinant Rabbit E-selectin (SELE),partial
SKU:CSB-YP020975RB
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P27113
Gene Names: SELE
Organism: Oryctolagus cuniculus (Rabbit)
AA Sequence: WTYHFSAENMTYDEASAYCQQNYTHLVAIQNKEEIDYLNSILDYSPSYYWIGIRKVNNVWIWVGTHKPLTEGAKNWAPGEPNNKQNNEDCVEIYIKRPKDTGMWNDERCSKKKLALCYTAACTEASCSGHGECIETINNYSCKCYPGFSGLKCEQVVTCEAQVQPQHGSLNCTHPLGNFSYNSSCSVSCERGYLPSSTETTWCTSSGEWSAPPATCKVVECDTMGKPANGDVKCSPSQGSAPWNTTCTFDCEEGFTLLGARSLQCTSSGSWDNEKPTCKAVSCDTIHHPQNGSVSCSNSSEGKFTFRSSCNFTCEENFLLRGPAQVECTAQGQWTQQAPVCEAVKCDPVHTLEDGFVKCTHPHTGEFTYKSSCTFNCREGFELHGSAQLECTSQGQWAQELPSCQVVQCPSLAVLGKTNVSCSGEPVFGTVCNFACPEGWTLNGSAALMCGAEGQWSGMLPTCEEPIASNVP
Expression Region: 24-495aa
Sequence Info: Extracellular Domain
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 53.6 kDa
Alternative Name(s): CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ;ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ;LECAM2;; CD62E
Relevance: Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis .
Reference: Characterization of cDNA and genomic sequences encoding rabbit ELAM-1 conservation of structure and functional interactions with leukocytes.Larigan J.D., Tsang T.C., Rumberger J.M., Burns D.K.DNA Cell Biol. 11:149-162(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
