Gene Bio Systems
Recombinant Quaternary ammonium compound-resistance protein qacH(qacH)
Recombinant Quaternary ammonium compound-resistance protein qacH(qacH)
SKU:CSB-CF528345FLR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus saprophyticus
Uniprot NO.:O87868
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPYLYLLLSIVSEVIGSAFLKSSDGFSKLYPTITTIISFLICFYFLSKTMQHLPLNITYA SWAGLGLVLTTIVSVLIFKEQINLISIISIILIIFGVVLLNTFGSSH
Protein Names:Recommended name: Quaternary ammonium compound-resistance protein qacH Alternative name(s): Quaternary ammonium determinant H
Gene Names:Name:qacH
Expression Region:1-107
Sequence Info:full length protein
