Recombinant Quaternary ammonium compound-resistance protein qacC(qacC)

SKU: CSB-CF319681FKZ

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus

Uniprot NO.:P14319

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPYIYLIIAISTEVIGSAFLKSSEGFSKFIPSLGTIISFGICFYFLSKTMQHLPLNITYA TWAGLGLVLTTVVSIIIFKEQINLITIVSIVLIIVGVVSLNIFGTSH

Protein Names:Recommended name: Quaternary ammonium compound-resistance protein qacC Alternative name(s): Ethidium bromide resistance protein Multidrug resistance protein Quaternary ammonium determinant C

Gene Names:Name:qacC Synonyms:ebr, smr

Expression Region:1-107

Sequence Info:full length protein