Gene Bio Systems
Recombinant Pyrococcus kodakaraensis Protein CrcB homolog(crcB)
Recombinant Pyrococcus kodakaraensis Protein CrcB homolog(crcB)
SKU:CSB-CF683325FHY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Thermococcus kodakaraensis (strain KOD1))
Uniprot NO.:Q5JF03
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLRIAMAIALGGAFGAVARFYISGLLPVYRDFPVGTLMVNSIASLILGYLYGLLFWGFD VPPDWRAFFGTGFCGALSTFSTFSYETFSLLREREYLIATLNILANVIITIALVFAGFML ARR
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:TK0514
Expression Region:1-123
Sequence Info:full length protein
