Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrococcus abyssi UPF0056 membrane protein PYRAB02000(PYRAB02000)

Recombinant Pyrococcus abyssi UPF0056 membrane protein PYRAB02000(PYRAB02000)

SKU:CSB-CF896025FHV

Regular price $2,167.20 CAD
Regular price Sale price $2,167.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pyrococcus abyssi (strain GE5 / Orsay)

Uniprot NO.:Q9V274

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLQEILSSALLMLIMIDPSDKILLVSLLREDFHIEDVKSLIIRANIIGFLLLLIFAVAGK IILQDIFHIELDALRVAGGFVLFKIGLEALESGGMVTIKKEKNILALAAVPVATPLIAGP AAITAAITLTAEYGIVVSVTATFIAIVITAVLMLLSLYLMRGINKTALSVTIRIIGLFIM AIGAQMMISGAGGIVLSILKEA

Protein Names:Recommended name: UPF0056 membrane protein PYRAB02000

Gene Names:Ordered Locus Names:PYRAB02000 ORF Names:PAB2220

Expression Region:1-202

Sequence Info:full length protein

View full details