Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrobaculum calidifontis UPF0290 protein Pcal_2086 (Pcal_2086)

Recombinant Pyrobaculum calidifontis UPF0290 protein Pcal_2086 (Pcal_2086)

SKU:CSB-CF386695PZV

Regular price $2,112.60 CAD
Regular price Sale price $2,112.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pyrobaculum calidifontis (strain JCM 11548 / VA1)

Uniprot NO.:A3MXY4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNEIVQLFLLIWPPYVANGSAVLAARLRRRHPLDFGKNFLDGRRIFGDGKTFEGVAIGVS AGTLLGYAPNLAYSYLTLLDAFLLATAAIVGDLLGAFVKRRLCMPRGYPAFPLDQLDFLL MALLVYSLYRELHIPLLLAAVVLTPVIHRATNYAAYKLRLKKEPW

Protein Names:Recommended name: UPF0290 protein Pcal_2086

Gene Names:Ordered Locus Names:Pcal_2086

Expression Region:1-165

Sequence Info:full length protein

View full details