Gene Bio Systems
Recombinant Pyrobaculum arsenaticum UPF0290 protein Pars_2316 (Pars_2316)
Recombinant Pyrobaculum arsenaticum UPF0290 protein Pars_2316 (Pars_2316)
SKU:CSB-CF395408PZU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321)
Uniprot NO.:A4WN93
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDLFVFFALIWPPYVANGSAVLASRLKWRHPVDFGHNFVDGRRLFGDGKTYEGLAIGVVL GTVVGYLPNLLHPTLTLLDALILSVAALLGDLLGAFIKRRLCMPRGHPAFPLDQLDFILM AMLVRSLYADVPVEYIIAASVVTPIIHRATNIAAYILRLKKEPW
Protein Names:Recommended name: UPF0290 protein Pars_2316
Gene Names:Ordered Locus Names:Pars_2316
Expression Region:1-164
Sequence Info:full length protein
