Gene Bio Systems
Recombinant Pyrobaculum aerophilum UPF0290 protein PAE0660(PAE0660)
Recombinant Pyrobaculum aerophilum UPF0290 protein PAE0660(PAE0660)
SKU:CSB-CF849510FHU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827)
Uniprot NO.:Q8ZYR4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDLTVFFLLIWPPYVANGSAVFASRLKWRHPVDFGRNFIDGRRIFGDGKTYEGVAIGIAT GTVLGYFPNLVYHVIGVFDAFVLSASAVLGDLIGAFIKRRLCMPRGHPAFPLDQLDFLLT AFLVYSLFREIPVVYVLAAVVITPVIHRATNYVAYLLKLKKEPW
Protein Names:Recommended name: UPF0290 protein PAE0660
Gene Names:Ordered Locus Names:PAE0660
Expression Region:1-164
Sequence Info:full length protein
