Skip to product information
1 of 1

Gene Bio Systems

Recombinant Putative uroporphyrinogen-III C-methyltransferase(hemX)

Recombinant Putative uroporphyrinogen-III C-methyltransferase(hemX)

SKU:CSB-CF700574EYY

Regular price $2,119.60 CAD
Regular price Sale price $2,119.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Proteus mirabilis

Uniprot NO.:Q51887

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTEQKNTNENDLQNGTSKADDDIRYQEVKPVNNKRSGLIGSAVAILVILAIGGGLYYYTT QQATKLRDPDHLLSDNENPGITCALIPTDVKGVEIGHRHFPLNVPFMNGPTRGKDVFVPI DFIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGLKSAAMATGATLEF

Protein Names:Recommended name: Putative uroporphyrinogen-III C-methyltransferase Short name= Urogen-III methylase EC= 2.1.1.107

Gene Names:Name:hemX

Expression Region:1-170

Sequence Info:full length protein

View full details