Skip to product information
1 of 1

Gene Bio Systems

Recombinant Putative anionic 4-hydroxy-benzoate permease

Recombinant Putative anionic 4-hydroxy-benzoate permease

SKU:CSB-CF523458TMD

Regular price $2,111.20 CAD
Regular price Sale price $2,111.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Thauera aromatica

Uniprot NO.:O33821

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CGRRRGSLAWPDASSPSANPRPGAGAAESSACTTSGWSRWRTSLLVAGALLGLQWLPQLA GLWVACFGFGTGACIILALMFMGLRTENPRQAAALSGMAQCVGYLLAAFGPPLVGGLRDR SQDWNPALTVCLVLSLTMAAAGMLAGRNRRIRSASTAASTPAAG

Protein Names:Recommended name: Putative anionic 4-hydroxy-benzoate permease

Gene Names:

Expression Region:1-164

Sequence Info:full length protein

View full details